Structure of PDB 6ml3 Chain A Binding Site BS01

Receptor Information
>6ml3 Chain A (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHI
RIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCPECGLQFARLD
NLKAHLKIHSKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ml3 Structural basis of specific DNA binding by the transcription factor ZBTB24.
Resolution1.683 Å
Binding residue
(original residue number in PDB)
H423 K431 F442 T443 H451 I454 D472 R478 H479 L482 K487 R500 N503 H507 I510
Binding residue
(residue number reindexed from 1)
H21 K29 F40 T41 H49 I52 D70 R76 H77 L80 K85 R98 N101 H105 I108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ml3, PDBe:6ml3, PDBj:6ml3
PDBsum6ml3
PubMed31226215
UniProtQ80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 (Gene Name=Zbtb24)

[Back to BioLiP]