Structure of PDB 6mjc Chain A Binding Site BS01

Receptor Information
>6mjc Chain A (length=106) Species: 5478 (Nakaseomyces glabratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AETIEIIKDLFEHLCGVRVHRTYEDDTGLWFDTSQGSKNGIMDYKLGFVK
SEVDTEVIYVPLLKQRTAEELQELQKKLPDYLFETLSFPLRSLNQFYIKM
SKSLNK
Ligand information
>6mjc Chain B (length=28) Species: 5478 (Nakaseomyces glabratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SNAPTLGERLDSLHEIKSARRMDHFNDD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mjc The molecular basis of monopolin recruitment to the kinetochore.
Resolution1.79 Å
Binding residue
(original residue number in PDB)		R88 T89 Y90 E91 D92 T94 W97 K112 V133 Y154 E157 T158 L159 S160 F161 R164 S165 Q168 F169 K172
Binding residue
(residue number reindexed from 1)		R21 T22 Y23 E24 D25 T27 W30 K45 V60 Y81 E84 T85 L86 S87 F88 R91 S92 Q95 F96 K99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0033551 monopolin complex

View graph for
Cellular Component
External links
PDB RCSB:6mjc, PDBe:6mjc, PDBj:6mjc
PDBsum6mjc
PubMed31037469
UniProtQ6FVN3

[Back to BioLiP]