Structure of PDB 6miq Chain A Binding Site BS01

Receptor Information
>6miq Chain A (length=141) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEI
PATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKA
GERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6miq Structural insights into the pi-pi-pi stacking mechanism and DNA-binding activity of the YEATS domain.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		T61 F62 G80 W81 G82 G83 D104 F107 L108
Binding residue
(residue number reindexed from 1)		T65 F66 G84 W85 G86 G87 D108 F111 L112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6miq, PDBe:6miq, PDBj:6miq
PDBsum6miq
PubMed30385749
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]