Structure of PDB 6min Chain A Binding Site BS01

Receptor Information
>6min Chain A (length=139) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPA
TIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWAGFPLDISVFLLEKAGE
RKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6min Structural insights into the pi-pi-pi stacking mechanism and DNA-binding activity of the YEATS domain.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		H59 T61 F62 Q79 G80 W81 A82 G83 D104 F107 L108
Binding residue
(residue number reindexed from 1)		H61 T63 F64 Q81 G82 W83 A84 G85 D106 F109 L110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6min, PDBe:6min, PDBj:6min
PDBsum6min
PubMed30385749
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]