Structure of PDB 6mil Chain A Binding Site BS01

Receptor Information
>6mil Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
VVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRF
DYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mil Structural insights into the pi-pi-pi stacking mechanism and DNA-binding activity of the YEATS domain.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		H30 H56 S58 F59 G77 Y78 A79 G80 F81 D103 F105 L106 H107 L108 H111
Binding residue
(residue number reindexed from 1)		H30 H56 S58 F59 G77 Y78 A79 G80 F81 D103 F105 L106 H107 L108 H111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6mil, PDBe:6mil, PDBj:6mil
PDBsum6mil
PubMed30385749
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]