Structure of PDB 6mhf Chain A Binding Site BS01

Receptor Information
>6mhf Chain A (length=330) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVPRGSHMDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECK
QYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEG
VMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNY
IPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEG
VTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILF
LNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTK
EVYTHFTCATDTKNVQFVFDAVTDVIIKNN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mhf Structural basis for GPCR-independent activation of heterotrimeric Gi proteins.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Q204 R205 S206 E207 R208 K209 W211 I212 F215 S252 N256 K257 W258
Binding residue
(residue number reindexed from 1)		Q187 R188 S189 E190 R191 K192 W194 I195 F198 S235 N239 K240 W241
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019001 guanyl nucleotide binding
GO:0019003 GDP binding
GO:0019904 protein domain specific binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0031821 G protein-coupled serotonin receptor binding
GO:0032794 GTPase activating protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006906 vesicle fusion
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0008016 regulation of heart contraction
GO:0016239 positive regulation of macroautophagy
GO:0032930 positive regulation of superoxide anion generation
GO:0046039 GTP metabolic process
GO:0051048 negative regulation of secretion
GO:0051301 cell division
GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation
GO:2001234 negative regulation of apoptotic signaling pathway
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005834 heterotrimeric G-protein complex
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0030496 midbody
GO:0042588 zymogen granule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mhf, PDBe:6mhf, PDBj:6mhf
PDBsum6mhf
PubMed31363053
UniProtP08753|GNAI3_RAT Guanine nucleotide-binding protein G(i) subunit alpha-3 (Gene Name=Gnai3)

[Back to BioLiP]