Structure of PDB 6mha Chain A Binding Site BS01

Receptor Information

>6mha Chain A (length=53) Species: 7227 (Drosophila melanogaster)

EEWAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYE
ASR

Ligand information

>6mha Chain B (length=6) Species: 7227 (Drosophila melanogaster)

QTARKS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6mha Thermodynamic consequences of Tyr to Trp mutations in the cation-pi-mediated binding of trimethyllysine by the HP1 chromodomain
• Resolution: 1.497 Å
• Binding residue (original residue number in PDB): E23 W24 V26 W45 Y48 E56 N60 D62 C63 L66
• Binding residue (residue number reindexed from 1): E2 W3 V5 W24 Y27 E35 N39 D41 C42 L45

External links

• PDB: RCSB:6mha, PDBe:6mha, PDBj:6mha
• PDBsum: 6mha
• UniProt: P05205|HP1_DROME Heterochromatin protein 1 (Gene Name=Su(var)205)