Structure of PDB 6mg2 Chain A Binding Site BS01

Receptor Information
>6mg2 Chain A (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKV
EQLSRELSTLRNLFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mg2 Structural basis for effects of CpA modifications on C/EBP beta binding of DNA.
Resolution1.928 Å
Binding residue
(original residue number in PDB)		K269 Y274 R278 N282 V285 R289
Binding residue
(residue number reindexed from 1)		K2 Y7 R11 N15 V18 R22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6mg2, PDBe:6mg2, PDBj:6mg2
PDBsum6mg2
PubMed30566668
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]