Structure of PDB 6mew Chain A Binding Site BS01

Receptor Information
>6mew Chain A (length=162) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETV
RFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNG
GTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mew RFXANK ankyrin repeats in complex with a RFX7 peptide
Resolution1.78 Å
Binding residue
(original residue number in PDB)
Q96 Q100 F125 W130 A133 F134 T166 D187 N189 G190 Y196 R199 L233
Binding residue
(residue number reindexed from 1)
Q6 Q10 F35 W40 A43 F44 T76 D97 N99 G100 Y106 R109 L143
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6mew, PDBe:6mew, PDBj:6mew
PDBsum6mew
PubMed
UniProtO14593|RFXK_HUMAN DNA-binding protein RFXANK (Gene Name=RFXANK)

[Back to BioLiP]