Structure of PDB 6me1 Chain A Binding Site BS01

Receptor Information
>6me1 Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEVLVQSGAEVKKPGASVKVSCRAFGYTFTGNALHWVRQAPGQGLEWLGW
INPHSGDTTTSQKFQGRVYMTRDKSINTAFLDVTRLTSDDTGIYYCARDK
YYGNEAVGMDVWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPK
Ligand information
>6me1 Chain F (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGLGAVFLG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6me1 Capturing the inherent structural dynamics of the HIV-1 envelope glycoprotein fusion peptide.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		T30 G31 W50 I51 N52 H53 Y97 N100 E100A A100B
Binding residue
(residue number reindexed from 1)		T30 G31 W50 I51 N52 H54 Y101 N104 E105 A106
External links