Structure of PDB 6mbk Chain A Binding Site BS01

Receptor Information
>6mbk Chain A (length=483) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVT
FDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELF
LWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNS
FWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYF
YKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLAL
IPLWDMCNHTNGLITTGYNLEDDRCECVALQDFRAGEQIYIFYGTRSNAE
FVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARAGIPTSSVFAL
HFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSW
DNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLG
EKEILEKAVKSAAVNREYYRQQMEEKAPLPKYE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mbk SETD3 is an actin histidine methyltransferase that prevents primary dystocia.
Resolution1.69 Å
Binding residue
(original residue number in PDB)		M151 N153 I154 N211 R214 Q215 V247 Q254 N255 Q256 P258 W273 D274 T285 G286 Y287 L289 Y312 R315
Binding residue
(residue number reindexed from 1)		M132 N134 I135 N192 R195 Q196 V228 Q235 N236 Q237 P239 W254 D255 T266 G267 Y268 L270 Y293 R296
Enzymatic activity
Enzyme Commision number 2.1.1.85: protein-histidine N-methyltransferase.
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003779 actin binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008170 N-methyltransferase activity
GO:0008276 protein methyltransferase activity
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
GO:0016279 protein-lysine N-methyltransferase activity
GO:0018064 protein-L-histidine N-tele-methyltransferase activity
GO:0042800 histone H3K4 methyltransferase activity
GO:0046975 histone H3K36 methyltransferase activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0006338 chromatin remodeling
GO:0018021 peptidyl-histidine methylation
GO:0018023 peptidyl-lysine trimethylation
GO:0030047 actin modification
GO:0032259 methylation
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051149 positive regulation of muscle cell differentiation
GO:0070472 regulation of uterine smooth muscle contraction
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mbk, PDBe:6mbk, PDBj:6mbk
PDBsum6mbk
PubMed30626964
UniProtQ86TU7|SETD3_HUMAN Actin-histidine N-methyltransferase (Gene Name=SETD3)

[Back to BioLiP]