Structure of PDB 6mbc Chain A Binding Site BS01

Receptor Information
>6mbc Chain A (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVE
KNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGIL
IKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE
PK
Ligand information
>6mbc Chain B (length=23) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLLEKLAEYLRQMADEINKKYVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mbc Tertiary Structural Motif Sequence Statistics Enable Facile Prediction and Design of Peptides that Bind Anti-apoptotic Bfl-1 and Mcl-1.
Resolution1.752 Å
Binding residue
(original residue number in PDB)		E47 N51 L52 C55 Q73 K77 E78 D81 N85 G87 R88 T91 K146 K147 F148 E149 K151
Binding residue
(residue number reindexed from 1)		E48 N52 L53 C56 Q74 K78 E79 D82 N86 G88 R89 T92 K147 K148 F149 E150 K152
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6mbc, PDBe:6mbc, PDBj:6mbc
PDBsum6mbc
PubMed30773399
UniProtQ16548|B2LA1_HUMAN Bcl-2-related protein A1 (Gene Name=BCL2A1)

[Back to BioLiP]