Structure of PDB 6m75 Chain A Binding Site BS01

Receptor Information

>6m75 Chain A (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAMGTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGF
VDFDSPAAAQKAVSALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQEL
ENMLKPFGQVISTRILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIK
TPPGVSAPTEPLLCKFS

Ligand information

>6m75 Chain C (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cttatt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6m75 Hinge like domain motion facilitates human RBMS1 protein binding to proto-oncogene c-myc promoter.
Resolution	2.57 Å
Binding residue (original residue number in PDB)	N6 Y8 R10 K35 K46 Y48 F50 A76 K77
Binding residue (residue number reindexed from 1)	N6 Y8 R10 K35 K46 Y48 F50 A76 K77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Cellular Component
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6m75, PDBe:6m75, PDBj:6m75
PDBsum	6m75
PubMed	33999211
UniProt	P29558\|RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 (Gene Name=RBMS1)

[Back to BioLiP]