Structure of PDB 6m6v Chain A Binding Site BS01

Receptor Information
>6m6v Chain A (length=117) Species: 211586 (Shewanella oneidensis MR-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQLNENKIIKLLRDNIPKLQLIYLFGNSDIDIAVLAADTLDNIARWELAQ
KLASALDSDVDLVDLRSASTVLCQQVVTQGKQLWGTQQDDELFAVKTISM
YQHLQAERQAIIDDVMA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m6v Novel polyadenylylation-dependent neutralization mechanism of the HEPN/MNT toxin/antitoxin system.
Resolution3.08 Å
Binding residue
(original residue number in PDB)		R76 K106
Binding residue
(residue number reindexed from 1)		R66 K96
Enzymatic activity
Enzyme Commision number 2.7.7.108: protein adenylyltransferase.
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005524 ATP binding
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m6v, PDBe:6m6v, PDBj:6m6v
PDBsum6m6v
PubMed33045733
UniProtQ8ECH7|MNTA_SHEON Protein adenylyltransferase MntA (Gene Name=mntA)

[Back to BioLiP]