Structure of PDB 6lyc Chain A Binding Site BS01

Receptor Information
>6lyc Chain A (length=110) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEVKVIQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVSRQLIYSFT
TEHFPRVTNVATKRSNLDFSIRISNVTPEDAGTYYCVKFQRGSPDTEIQS
GGGTEVYVLA
Ligand information
>6lyc Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YRYSAVYSIHPSWCG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lyc Macrocyclic Peptide-Mediated Blockade of the CD47-SIRP alpha Interaction as a Potential Cancer Immunotherapy.
Resolution1.36 Å
Binding residue
(original residue number in PDB)		L52 I53 Y54 S55 F56 T57 T58 E59 H60 F61 S74 N75 D77 F78 S79 I80 R81 I82 S83 D89
Binding residue
(residue number reindexed from 1)		L45 I46 Y47 S48 F49 T50 T51 E52 H53 F54 S65 N66 D68 F69 S70 I71 R72 I73 S74 D80
External links