Structure of PDB 6lxn Chain A Binding Site BS01

Receptor Information
>6lxn Chain A (length=110) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKL
MNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPD
GSKALEHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lxn Structural basis for promoter DNA recognition by the response regulator OmpR.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		T28 G30 S66 R73 W92
Binding residue
(residue number reindexed from 1)		T27 G29 S65 R72 W91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lxn, PDBe:6lxn, PDBj:6lxn
PDBsum6lxn
PubMed33152421
UniProtP0AA16|OMPR_ECOLI DNA-binding dual transcriptional regulator OmpR (Gene Name=ompR)

[Back to BioLiP]