Structure of PDB 6lw5 Chain A Binding Site BS01

Receptor Information
>6lw5 Chain A (length=427) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLE
DKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRN
AYIQKYLTNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNG
LVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGW
FLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKV
IVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAI
TMLTARGIIRFVIGFLLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTA
VVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNS
CLNPMLYVFVGQDFRERLIHSLPTSLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lw5 Structural basis of ligand binding modes at the human formyl peptide receptor 2.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		F5 E89 D106 L109 F110 T177 F180 L198 R201 R205 W254 F257 A261 D281 V284 N285 F292
Binding residue
(residue number reindexed from 1)		F110 E194 D211 L214 F215 T282 F285 L303 R306 R310 W359 F362 A366 D386 V389 N390 F397
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001540 amyloid-beta binding
GO:0004875 complement receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004982 N-formyl peptide receptor activity
GO:0005124 scavenger receptor binding
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0038023 signaling receptor activity
GO:0038024 cargo receptor activity
GO:0046872 metal ion binding
Biological Process
GO:0001774 microglial cell activation
GO:0002430 complement receptor mediated signaling pathway
GO:0002768 immune response-regulating cell surface receptor signaling pathway
GO:0006898 receptor-mediated endocytosis
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0007155 cell adhesion
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0019722 calcium-mediated signaling
GO:0022900 electron transport chain
GO:0032930 positive regulation of superoxide anion generation
GO:0042742 defense response to bacterium
GO:0045089 positive regulation of innate immune response
GO:0048143 astrocyte activation
GO:0050728 negative regulation of inflammatory response
GO:0050766 positive regulation of phagocytosis
GO:0050918 positive chemotaxis
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0090026 positive regulation of monocyte chemotaxis
GO:1904646 cellular response to amyloid-beta
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0035579 specific granule membrane
GO:0042597 periplasmic space
GO:0070821 tertiary granule membrane
GO:0101003 ficolin-1-rich granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lw5, PDBe:6lw5, PDBj:6lw5
PDBsum6lw5
PubMed32139677
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P25090|FPR2_HUMAN N-formyl peptide receptor 2 (Gene Name=FPR2)

[Back to BioLiP]