Structure of PDB 6lui Chain A Binding Site BS01

Receptor Information
>6lui Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPHYQEWILDTIDSLRSRKARPDLERICRMVRRRHGPEPERTRAELEKLI
QQRAVLRVSYKGSISYRNAAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lui The SAM domain-containing protein 1 (SAMD1) acts as a repressive chromatin regulator at unmethylated CpG islands.
Resolution1.781 Å
Binding residue
(original residue number in PDB)		R45 K46 R56 R60 K88
Binding residue
(residue number reindexed from 1)		R18 K19 R29 R33 K61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6lui, PDBe:6lui, PDBj:6lui
PDBsum6lui
PubMed33980486
UniProtQ6SPF0|SAMD1_HUMAN Sterile alpha motif domain-containing protein 1 (Gene Name=SAMD1)

[Back to BioLiP]