Structure of PDB 6lsd Chain A Binding Site BS01

Receptor Information
>6lsd Chain A (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFV
KKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRI
DIIHNLKLDRTYTGLQTLGAETVVDVELHR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lsd Histone benzoylation serves as an epigenetic mark for DPF and YEATS family proteins.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		S230 H259 S261 Y262 G281 W282 G283 E284 R311
Binding residue
(residue number reindexed from 1)		S29 H58 S60 Y61 G80 W81 G82 E83 R110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6lsd, PDBe:6lsd, PDBj:6lsd
PDBsum6lsd
PubMed33290558
UniProtQ9ULM3|YETS2_HUMAN YEATS domain-containing protein 2 (Gene Name=YEATS2)

[Back to BioLiP]