Structure of PDB 6lqf Chain A Binding Site BS01

Receptor Information
>6lqf Chain A (length=175) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKHDCGRAHIQVCSEEEFLRDVMQFLLIRGHTRLVPPGGLAEFPDAVLNS
KRLDLFNLYREVVSRGGFHVGNGINWKGQVFSKMRNHTLTNRMTGVGNTL
KRHYETYLLEYEYAHDDVDGECCLICRSSTAGDWVNCGSCGEWAHFGCDR
RPGLGAFKDYAKTDGLEYVCPNCSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqf Dual Recognition of H3K4me3 and DNA by the ISWI Component ARID5 Regulates the Floral Transition in Arabidopsis.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		E615 S618 R619 G627 Q633 D673 G686 D687 W688 V689 N690 W697 F711 Y714 A715 L720
Binding residue
(residue number reindexed from 1)		E61 S64 R65 G73 Q79 D119 G132 D133 W134 V135 N136 W143 F157 Y160 A161 L166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6lqf, PDBe:6lqf, PDBj:6lqf
PDBsum6lqf
PubMed32358072
UniProtQ6NQ79|ARID4_ARATH AT-rich interactive domain-containing protein 4 (Gene Name=ARID4)

[Back to BioLiP]