Structure of PDB 6lqe Chain A Binding Site BS01

Receptor Information
>6lqe Chain A (length=55) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECCLICRSSTAGDWVNCGSCGEWAHFGCDRRPGLGAFKDYAKTDGLEYVC
PNCSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqe Dual Recognition of H3K4me3 and DNA by the ISWI Component ARID5 Regulates the Floral Transition in Arabidopsis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		S683 A685 G686 W688 N690 W697 F711 Y714 A715 L720
Binding residue
(residue number reindexed from 1)		S9 A11 G12 W14 N16 W23 F37 Y40 A41 L46
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6lqe, PDBe:6lqe, PDBj:6lqe
PDBsum6lqe
PubMed32358072
UniProtQ6NQ79|ARID4_ARATH AT-rich interactive domain-containing protein 4 (Gene Name=ARID4)

[Back to BioLiP]