Structure of PDB 6lpg Chain A Binding Site BS01

Receptor Information
>6lpg Chain A (length=249) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIP
IPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMD
LAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHI
VLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLK
KVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLK
Ligand information
>6lpg Chain B (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SAQQELKQRQRAEIYALNRVMTELEQQQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lpg The crystal structure of the tetrameric human vasohibin-1-SVBP complex reveals a variable arm region within the structural core.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		L67 P68 V69 W74 V81 I84 H85 I95 R96 G97 A98 I104 P105 L132 Q133 Y134 H136 T137 F141 E163 A164 L165 P166 R222
Binding residue
(residue number reindexed from 1)		L12 P13 V14 W19 V26 I29 H30 I40 R41 G42 A43 I49 P50 L77 Q78 Y79 H81 T82 F86 E108 A109 L110 P111 R167
Enzymatic activity
Enzyme Commision number 3.4.17.17: tubulinyl-Tyr carboxypeptidase.
Gene Ontology
Biological Process
GO:0045765 regulation of angiogenesis
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lpg, PDBe:6lpg, PDBj:6lpg
PDBsum6lpg
PubMed33021501
UniProtQ7L8A9|VASH1_HUMAN Tubulinyl-Tyr carboxypeptidase 1 (Gene Name=VASH1)

[Back to BioLiP]