Structure of PDB 6los Chain A Binding Site BS01

Receptor Information
>6los Chain A (length=369) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPVEEEDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVAT
ALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEKNLK
SASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQ
MKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDR
TVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLT
MIEESLTSEFIHDIDRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSL
FESPDFSKITGKPVKLTQVEHRAAFEWNEEGAGSSFPLDYHLNQPFLFVL
RDTDTGALLFIGRILDPSS
Ligand information
>6los Chain G (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGPPGPPGPKGHRGFSGLPGPPGPPGP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6los Spatiotemporal regulation of PEDF signaling by type I collagen remodeling.
Resolution2.476 Å
Binding residue
(original residue number in PDB)		D255 D299 K305
Binding residue
(residue number reindexed from 1)		D219 D263 K269
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0001822 kidney development
GO:0007614 short-term memory
GO:0010447 response to acidic pH
GO:0010596 negative regulation of endothelial cell migration
GO:0010629 negative regulation of gene expression
GO:0010976 positive regulation of neuron projection development
GO:0014070 response to organic cyclic compound
GO:0016525 negative regulation of angiogenesis
GO:0042698 ovulation cycle
GO:0046685 response to arsenic-containing substance
GO:0050769 positive regulation of neurogenesis
GO:0060041 retina development in camera-type eye
GO:0060767 epithelial cell proliferation involved in prostate gland development
GO:0060770 negative regulation of epithelial cell proliferation involved in prostate gland development
GO:0071279 cellular response to cobalt ion
GO:0071300 cellular response to retinoic acid
GO:0071333 cellular response to glucose stimulus
GO:0071549 cellular response to dexamethasone stimulus
GO:1901652 response to peptide
Cellular Component
GO:0005576 extracellular region
GO:0005604 basement membrane
GO:0005615 extracellular space
GO:0030424 axon
GO:0042470 melanosome
GO:0043025 neuronal cell body
GO:0043203 axon hillock
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6los, PDBe:6los, PDBj:6los
PDBsum6los
PubMed32385162
UniProtP97298|PEDF_MOUSE Pigment epithelium-derived factor (Gene Name=Serpinf1)

[Back to BioLiP]