Structure of PDB 6lnc Chain A Binding Site BS01

Receptor Information
>6lnc Chain A (length=197) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KWYYKTITFLPELCNNESLAAKCLRVLHGFNYQYETRNIGVSFPLWCDAT
VGKKISFVSKNKIELDLLLKQHYFVQMEQLQYFHISNTVLVPEDCTYVSF
RRCQSIDKLTAAGLARKIRRLEKRALSRGEQFDPSSFAQKEHTAIAHYHS
LGESSKQTNRNFRLNIRMLSEQPREGNSIFSSYGLSNSENSFQPVPL
Ligand information
>6lnc Chain M (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugauaacuucacggcgggcuugauguccgcgucuaccuggugaacugcc
gaguagguag
.............................................<<<<<
.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lnc Structural basis of a Tn7-like transposase recruitment and DNA loading to CRISPR-Cas surveillance complex.
Resolution3.21 Å
Binding residue
(original residue number in PDB)		Q105 I107 R117 K118 R120 R121 L122 K124 R125 A139 K141 S156 K157 R161 F163 R164 S182 S183 Y184
Binding residue
(residue number reindexed from 1)		Q104 I106 R116 K117 R119 R120 L121 K123 R124 A138 K140 S155 K156 R160 F162 R163 S181 S182 Y183
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Nov 17 03:06:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6lnc', asym_id = 'A', bs = 'BS01', title = 'Structural basis of a Tn7-like transposase recru...d DNA loading to CRISPR-Cas surveillance complex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6lnc', asym_id='A', bs='BS01', title='Structural basis of a Tn7-like transposase recru...d DNA loading to CRISPR-Cas surveillance complex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004519,0043571', uniprot = '', pdbid = '6lnc', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0043571', uniprot='', pdbid='6lnc', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>