Structure of PDB 6lmr Chain A Binding Site BS01

Receptor Information
>6lmr Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYL
RSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lmr Structural basis of DNA binding to human YB-1 cold shock domain regulated by phosphorylation.
ResolutionN/A
Binding residue
(original residue number in PDB)		W65 N67 R69 F74 F85 H87 E117 K118 E121 K137 Y138
Binding residue
(residue number reindexed from 1)		W15 N17 R19 F24 F35 H37 E67 K68 E71 K87 Y88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6lmr, PDBe:6lmr, PDBj:6lmr
PDBsum6lmr
PubMed32710623
UniProtP67809|YBOX1_HUMAN Y-box-binding protein 1 (Gene Name=YBX1)

[Back to BioLiP]