Structure of PDB 6lmj Chain A Binding Site BS01

Receptor Information
>6lmj Chain A (length=99) Species: 10497 (African swine fever virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPTITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIPPG
IKFTVVTVKAKPARQGHNPATGEPIQIKAKPEHKAVKIRALKPVHDMLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lmj The structural basis of African swine fever virus pA104R binding to DNA and its inhibition by stilbene derivatives.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H78 P80
Binding residue
(residue number reindexed from 1)		H67 P69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005829 cytosol
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lmj, PDBe:6lmj, PDBj:6lmj
PDBsum6lmj
PubMed32358196
UniProtP68742|VHLP_ASFB7 Viral histone-like protein (Gene Name=BA71V-033)

[Back to BioLiP]