Structure of PDB 6lhg Chain A Binding Site BS01

Receptor Information
>6lhg Chain A (length=272) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELHTLRYIRTAMTDPGPGQPWFVTVGYVDGELFVHYNSTARRYVPRTEWI
AANTDQQYWDGQTQIGQLNEQINRENLGIRQRRYNQTGGSHTVQWMFGCD
ILEDGTIRGYRQSAYDGRDFIALDKDMKTFTAAVPEAVPTKRKWEEESEP
ERWKNYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCR
AHGFYPRPIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIEAQPGDG
DKYQCRVEHASLPQPGLYSWKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lhg The Combination of CD8 alpha alpha and Peptide-MHC-I in a Face-to-Face Mode Promotes Chicken gamma delta T Cells Response.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y7 R9 Y43 Q62 I65 N69 I72 N76 R80 R111 T140 K143 W144 R152 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)		Y7 R9 Y43 Q62 I65 N69 I72 N76 R80 R111 T140 K143 W144 R152 Y156 W164 Y168
Enzymatic activity
Enzyme Commision number ?
External links