Structure of PDB 6lhf Chain A Binding Site BS01

Receptor Information
>6lhf Chain A (length=270) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELHTLRYISTAMTDPGPGQPWYVDVGYVDGELFTHYNSTARRAVPRTEWI
AANTDQQYWDSETQTSQRTEQIDRDGLGTLQRRYNQTGGSHTVQLMYGCD
ILEDGTIRGYSQDAYDGRDFIAFDKDTMTFTAAVPEAVPTKRKWEEGDYA
EGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCR
AHGFYPRPIAVSWLKDGAVQGQDAQSGGIVPNGDGTYHTWVTIDAQPGDG
DKYQCRVEHASLPQPGLYSW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lhf The Combination of CD8 alpha alpha and Peptide-MHC-I in a Face-to-Face Mode Promotes Chicken gamma delta T Cells Response.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y10 D27 T37 Y61 E65 T68 S69 R71 T72 I75 R86 L98 Y100 D116 K146 W147 Y152 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 D24 T34 Y58 E62 T65 S66 R68 T69 I72 R83 L95 Y97 D113 K143 W144 Y149 L153 Y156 W164 Y168
Enzymatic activity
Enzyme Commision number ?
External links