Structure of PDB 6lf8 Chain A Binding Site BS01

Receptor Information
>6lf8 Chain A (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVP
WIQQEGQEYWDRETRNVKETAQTYGVGLNTLRGYYNQSEAGSHTLQSMYG
CYLGPDGLLLHGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEAA
DEAERRRSYLQGLCVESLRRYLEMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
>6lf8 Chain C (length=12) Species: 11309 (unidentified influenza virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RVEDVTNTAEYW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lf8 Structure and Peptidomes of Swine MHC Class I with Long Peptides Reveal the Cross-Species Characteristics of the Novel N-Terminal Extension Presentation Mode.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		L5 Y7 M45 Y59 E63 V67 E69 T70 T73 Y74 V76 G77 T80 L81 Y84 Y99 D116 T143 K146 W147 E152 R155 R156 Y159 L163 E166 S167 R170 Y171
Binding residue
(residue number reindexed from 1)		L5 Y7 M45 Y59 E63 V67 E69 T70 T73 Y74 V76 G77 T80 L81 Y84 Y99 D116 T143 K146 W147 E152 R155 R156 Y159 L163 E166 S167 R170 Y171
Enzymatic activity
Enzyme Commision number ?
External links