Structure of PDB 6le9 Chain A Binding Site BS01

Receptor Information
>6le9 Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6le9 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaccctaaccctaaccctaaccctaaccctaaccctaaccctaaccct
aaccctaaccctaaccctaaccctaaccctaaccctaaccctaaccctaa
ccctaaccctaaccctaaccctaaccctaaccctaaccctaagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6le9 The human telomeric nucleosome displays distinct structural and dynamic properties.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
Y41 R42 P43 T45 R63 R72 R83 Q85 R116 V117 T118
Binding residue
(residue number reindexed from 1)
Y2 R3 P4 T6 R24 R33 R44 Q46 R77 V78 T79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6le9, PDBe:6le9, PDBj:6le9
PDBsum6le9
PubMed
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]