Structure of PDB 6ldm Chain A Binding Site BS01

Receptor Information
>6ldm Chain A (length=191) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVY
LSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIA
VKKQFYRDLFQIDPDTGRSLITDEPNFAAYRTQSRRGPIAREFFKHFAEE
HAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNRPEPM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ldm Structural basis of G-quadruplex DNA recognition by the yeast telomeric protein Rap1.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T399 N401 S402 H405 R406 R408 Y410 R523 R546
Binding residue
(residue number reindexed from 1)		T39 N41 S42 H45 R46 R48 Y50 R141 R164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ldm, PDBe:6ldm, PDBj:6ldm
PDBsum6ldm
PubMed32187364
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]