Structure of PDB 6lcs Chain A Binding Site BS01

Receptor Information
>6lcs Chain A (length=168) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKLQQSGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKFEYLGYI
SYSGRTYYNPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCSRPYYR
YDYAIDYWGQGTTVTVCSGSDYEFLKSWTVEDLQKRLLALDPMMEQEIEE
IRQKYQSKRQPILDAIEA
Ligand information
Ligand IDE9R
InChIInChI=1S/C20H24N2O6/c23-13-16-9-11-22(12-18(16)24)10-5-4-8-17(19(25)26)21-20(27)28-14-15-6-2-1-3-7-15/h1-3,6-7,9,11-12,17,23H,4-5,8,10,13-14H2,(H2-,21,24,25,26,27)/p+1/t17-/m0/s1
InChIKeyMCKINXUETXTBTK-KRWDZBQOSA-O
SMILES
SoftwareSMILES
CACTVS 3.385OCc1cc[n+](CCCC[C@H](NC(=O)OCc2ccccc2)C(O)=O)cc1O
OpenEye OEToolkits 2.0.7c1ccc(cc1)COC(=O)NC(CCCC[n+]2ccc(c(c2)O)CO)C(=O)O
CACTVS 3.385OCc1cc[n+](CCCC[CH](NC(=O)OCc2ccccc2)C(O)=O)cc1O
OpenEye OEToolkits 2.0.7c1ccc(cc1)COC(=O)N[C@@H](CCCC[n+]2ccc(c(c2)O)CO)C(=O)O
FormulaC20 H25 N2 O6
Name(2~{S})-6-[4-(hydroxymethyl)-3-oxidanyl-pyridin-1-ium-1-yl]-2-(phenylmethoxycarbonylamino)hexanoic acid
ChEMBL
DrugBank
ZINC
PDB chain6lcs Chain A Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lcs Molecular recognition of a single-chain Fv antibody specific for GA-pyridine, an advanced glycation end-product (AGE), elucidated using biophysical techniques and synthetic antigen analogues.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y33 N35 Y47 Y50 P95 Y100A
Binding residue
(residue number reindexed from 1)		Y32 N34 Y46 Y49 P97 Y103
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 05:06:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6lcs', asym_id = 'A', bs = 'BS01', title = 'Molecular recognition of a single-chain Fv antib...ical techniques and synthetic antigen analogues. '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6lcs', asym_id='A', bs='BS01', title='Molecular recognition of a single-chain Fv antib...ical techniques and synthetic antigen analogues. ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004674,0007165,0051262', uniprot = '', pdbid = '6lcs', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004674,0007165,0051262', uniprot='', pdbid='6lcs', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>