Structure of PDB 6lb4 Chain A Binding Site BS01

Receptor Information

>6lb4 Chain A (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NEDMPVERILEAELAVEPYVEADPVTNICQAADKQLFTLVEWAKRIPHFS
ELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSA
GVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVE
ALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFK
LIGDTPIDTFLMEMLEAP

Ligand information

>6lb4 Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KHKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6lb4 Crystal structure of dimeric RXR-LBD complexed with NEt-3ME and TIF2 co-activator
Resolution	1.5 Å
Binding residue (original residue number in PDB)	F277 V280 K284 L294 V298 R302 T449 F450 E453
Binding residue (residue number reindexed from 1)	F37 V40 K44 L54 V58 R62 T209 F210 E213

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lb4, PDBe:6lb4, PDBj:6lb4
PDBsum	6lb4
PubMed
UniProt	P19793\|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]