Structure of PDB 6l71 Chain A Binding Site BS01

Receptor Information

>6l71 Chain A (length=296) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTG
LYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFM
RLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRH
EYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFL
KVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGGMDF
DSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ

Ligand information

>6l71 Chain C (length=6) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PRKQLA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6l71 Sirtuin 2 protein with H3K18 myristoylated peptide
Resolution	2.109 Å
Binding residue (original residue number in PDB)	H187 V233 F234 F235 E237 L239 Q265 V266 Q267
Binding residue (residue number reindexed from 1)	H135 V181 F182 F183 E185 L187 Q213 V214 Q215

Enzymatic activity

Catalytic site (original residue number in PDB)	P94 D95 F96 R97 N168 D170 H187
Catalytic site (residue number reindexed from 1)	P42 D43 F44 R45 N116 D118 H135
Enzyme Commision number	2.3.1.- 2.3.1.286: protein acetyllysine N-acetyltransferase.

Gene Ontology

	Molecular Function
GO:0017136	NAD-dependent histone deacetylase activity
GO:0051287	NAD binding
GO:0070403	NAD+ binding

View graph for
Molecular Function

External links

PDB	RCSB:6l71, PDBe:6l71, PDBj:6l71
PDBsum	6l71
PubMed
UniProt	Q8IXJ6\|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 (Gene Name=SIRT2)

[Back to BioLiP]