Structure of PDB 6l6q Chain A Binding Site BS01

Receptor Information
>6l6q Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRR
RNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l6q Structural basis of binding of homodimers of the nuclear receptor NR4A2 to selective Nur-responsive DNA elements.
Resolution2.601 Å
Binding residue
(original residue number in PDB)		C272 Q273 Y275 V333 R334 R341 G343
Binding residue
(residue number reindexed from 1)		C11 Q12 Y14 V72 R73 R80 G82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6l6q, PDBe:6l6q, PDBj:6l6q
PDBsum6l6q
PubMed31723028
UniProtP43354|NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 (Gene Name=NR4A2)

[Back to BioLiP]