Structure of PDB 6l5z Chain A Binding Site BS01

Receptor Information
>6l5z Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKV
VFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFD
YDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l5z Selective Targeting of AF9 YEATS Domain by Cyclopeptide Inhibitors with Preorganized Conformation.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		A79 G80 L106 H107 L108 H111
Binding residue
(residue number reindexed from 1)		A78 G79 L105 H106 L107 H110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6l5z, PDBe:6l5z, PDBj:6l5z
PDBsum6l5z
PubMed33306911
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]