Structure of PDB 6l2o Chain A Binding Site BS01

Receptor Information
>6l2o Chain A (length=217) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEASVSFENGKIVVRLPITRPTSKIRVKKIENGVGIPVSTRKKSFPSDEN
LRDYYIEWQISFARDGKYDYELSRMVRLAHEHGILTYNDIYELLKFADDV
KSYLEDKGIRRESTNEELYGFNIYEDVYPVAKKELPSGEFIGIVLKHAQR
AVGYQSMVYVCIPLTNVEPSLAGRVARRNEVVKYEVPVDLMKELLKAFII
ASETHKNDIVKFLRSII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l2o Distortion of double-stranded DNA structure by the binding of the restriction DNA glycosylase R.PabI.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
M7 R26 T28 S29 K30 R156
Binding residue
(residue number reindexed from 1)
M1 R20 T22 S23 K24 R150
Enzymatic activity
Enzyme Commision number ?
External links