Structure of PDB 6l1w Chain A Binding Site BS01

Receptor Information
>6l1w Chain A (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEVFCFITKILCAHGGRMTLEELLGEISLPEAQLYELLKAAGPDRFVLLE
TRSVVATTRARVCRRKYCQRPCDSLHLCKLNLLGRCHYAQSQRNLCKYSH
DVLSEQNFQVLKNHELSGLNQEELAVLLVQSDPFFMPEICKSYKGEGRKQ
ICGQPQPCERLHICEHFTRGNCSYLNCLRSHNLMDRKVLAIMREHGLSSD
VVQNIQDICNNKHTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l1w Molecular Mechanism of RNA Recognition by Zinc-Finger Antiviral Protein.
Resolution2.194 Å
Binding residue
(original residue number in PDB)		C88 K89 L90 H97 Y98 L105 C106 K107 Y108 F144 E148 I149 C150 K151 R170
Binding residue
(residue number reindexed from 1)		C78 K79 L80 H87 Y88 L95 C96 K97 Y98 F134 E138 I139 C140 K141 R160
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6l1w, PDBe:6l1w, PDBj:6l1w
PDBsum6l1w
PubMed31914396
UniProtQ3UPF5|ZCCHV_MOUSE Zinc finger CCCH-type antiviral protein 1 (Gene Name=Zc3hav1)

[Back to BioLiP]