Structure of PDB 6kzh Chain A Binding Site BS01

Receptor Information

>6kzh Chain A (length=230) Species: 9606 (Homo sapiens)

QGEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYK
NVVGGRRSAWRVISSIEQKTTSDKKLQLIKDYREKVESELRSICTTVLEL
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQ
EAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTS

Ligand information

>6kzh Chain C (length=5) Species: 9606 (Homo sapiens)

TQSLS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6kzh 14-3-3 protein in Complex with CIC S173 phosphorylated peptide
• Resolution: 2.645 Å
• Binding residue (original residue number in PDB): K49 R56 R127 Y128 L172 N173 E180 L220 D223 N224 W228
• Binding residue (residue number reindexed from 1): K50 R57 R127 Y128 L172 N173 E180 L220 D223 N224 W228

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0042802 identical protein binding
• GO:0044325 transmembrane transporter binding
• GO:0071889 14-3-3 protein binding

Biological Process

• GO:0006605 protein targeting
• GO:0007165 signal transduction
• GO:0007264 small GTPase-mediated signal transduction
• GO:0008104 protein localization
• GO:0021762 substantia nigra development
• GO:0034766 negative regulation of monoatomic ion transmembrane transport
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0045202 synapse
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6kzh, PDBe:6kzh, PDBj:6kzh
• PDBsum: 6kzh
• UniProt: P27348|1433T_HUMAN 14-3-3 protein theta (Gene Name=YWHAQ)