Structure of PDB 6kz1 Chain A Binding Site BS01

Receptor Information
>6kz1 Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPGSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKV
GHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kz1 Phase separation-mediated condensation of Whirlin-Myo15-Eps8 stereocilia tip complex.
Resolution1.694 Å
Binding residue
(original residue number in PDB)
L826 G827 I828 A829 I830 E831 H877
Binding residue
(residue number reindexed from 1)
L16 G17 I18 A19 I20 E21 H67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6kz1, PDBe:6kz1, PDBj:6kz1
PDBsum6kz1
PubMed33626355
UniProtQ9P202|WHRN_HUMAN Whirlin (Gene Name=WHRN)

[Back to BioLiP]