Structure of PDB 6kyu Chain A Binding Site BS01

Receptor Information
>6kyu Chain A (length=271) Species: 8839 (Anas platyrhynchos) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPHSLRYFDTGVSDPSPGVPRFVSVGYVDGHLIDHYDSETQRTEPRADWF
AANTDQQYWDRQTEISRGAEQIFRLDLETLRERYNQSRGSHTWQLMYGCD
LLEDGSTRGFRQYGYEGRDFVAFDKDTLTFTAADAGAQITKRKWEQEGTD
AERWKFYLENTCIEGLRKYVSYGKDVLERRERPEVQVSGMEADKILTLSC
RAHGFYPRPISISWLKDGMVQEQETKRGSTVPNSDGTYHIWATIDVLPGE
RDKYQCRVEHASLPQPGLFSW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kyu Complex assembly, crystallization and preliminary X-ray crystallographic analysis of the duck pAnpl-UAA
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Y7 S24 D34 Q62 E64 I65 S66 I72 D76 L80 L95 Y97 T140 K143 W144 E147 D150 R153 W154 Y157 T161 Y169
Binding residue
(residue number reindexed from 1)		Y7 S24 D34 Q62 E64 I65 S66 I72 D76 L80 L95 Y97 T140 K143 W144 E147 D150 R153 W154 Y157 T161 Y169
Enzymatic activity
Enzyme Commision number ?
External links