Structure of PDB 6kxv Chain A Binding Site BS01

Receptor Information
>6kxv Chain A (length=94) Species: 5664 (Leishmania major) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RWRPGTCAIREIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAI
MALQEATEAYIVSLMADTNLACIHAKRVTIQPKDIQLALRLRGE
Ligand information
>6kxv Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kxv Incorporation and influence of Leishmania histone H3 in chromatin.
Resolution3.63 Å
Binding residue
(original residue number in PDB)		W35 R36 Q57 R66 R77 F78 Q79 V111 T112 Q114
Binding residue
(residue number reindexed from 1)		W2 R3 Q24 R33 R44 F45 Q46 V78 T79 Q81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6kxv, PDBe:6kxv, PDBj:6kxv
PDBsum6kxv
PubMed31722422
UniProtQ4QHB5

[Back to BioLiP]