Structure of PDB 6kx9 Chain A Binding Site BS01

Receptor Information
>6kx9 Chain A (length=272) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFELHTLRYISTAMTDPGPGQPWYVDVGYVDGELFTHYNSTARRAVPRTE
WIAANTDQQYWDSETQTSQRTEQIDRDGLGTLQRRYNQTGGSHTVQLMYG
CDILEDGTIRGYSQDAYDGRDFIAFDKDTMTFTAAVPEAVPTKRKWEEGD
YAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLS
CRAHGFYPRPIAVSWLKDGAVQGQDAQSGGIVPNGDGTYHTWVTIDAQPG
DGDKYQCRVEHASLPQPGLYSW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kx9 Structures of the MHC-I molecule BF2*1501 disclose the preferred presentation of an H5N1 virus-derived epitope.
Resolution2.902 Å
Binding residue
(original residue number in PDB)
Y10 D27 T37 E65 I75 D76 L98 Y100 D116 T143 K146 W147 Y159 T163 Y171
Binding residue
(residue number reindexed from 1)
Y9 D26 T36 E64 I74 D75 L97 Y99 D115 T142 K145 W146 Y158 T162 Y170
Enzymatic activity
Enzyme Commision number ?
External links