Structure of PDB 6kwo Chain A Binding Site BS01

Receptor Information
>6kwo Chain A (length=272) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVPW
IQQEGQDYWDEETRKVKDNAQTYGVGLNTLRGYYNQSEAGSHTLQSMFGC
YLGPDGLLLHGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEAAN
VAERRRSYLQGLCVESLRRYLEMGKDTLQRAEPPKTHVTRHPSSDLGVTL
RCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVPP
GEEQSYTCHVQHEGLQEPLTLR
Ligand information
>6kwo Chain C (length=9) Species: 981614 (Neuraminidase deficient flu strains) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ESDTVGWSW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kwo Peptidomes and Structures Illustrate Two Distinguishing Mechanisms of Alternating the Peptide Plasticity Caused by Swine MHC Class I Micropolymorphism.
Resolution1.803 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 N70 T73 Y74 Y84 D116 K146 W147 A150 R155 R156 Y159 L163 S167 R170 Y171
Binding residue
(residue number reindexed from 1)		Y6 E62 K65 N69 T72 Y73 Y83 D115 K145 W146 A149 R154 R155 Y158 L162 S166 R169 Y170
Enzymatic activity
Enzyme Commision number ?
External links