Structure of PDB 6kwn Chain A Binding Site BS01

Receptor Information
>6kwn Chain A (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVP
WIQQEGQDYWDEETRKVKDNAQTYGVGLNTLRGYYNQSEAGSHTLQSMYG
CYLGPDGLLLHGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEAA
NVAERRRSYLQGLCVESLRRYLEMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kwn Peptidomes and Structures Illustrate Two Distinguishing Mechanisms of Alternating the Peptide Plasticity Caused by Swine MHC Class I Micropolymorphism.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 N70 T73 Y74 G77 Y84 Y99 D116 T143 K146 W147 A150 R156 Y159 L163 S167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 N70 T73 Y74 G77 Y84 Y99 D116 T143 K146 W147 A150 R156 Y159 L163 S167 Y171
Enzymatic activity
Enzyme Commision number ?
External links