Structure of PDB 6kwk Chain A Binding Site BS01

Receptor Information
>6kwk Chain A (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVP
WIQQEGQEYWDRETRNVKETAQTYGVGLNTLRGYYNQSEAGSHTLQSMYG
CYLGPDGLLLHGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEAA
DEAERRRSYLQGLCVESLRRYLEMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
>6kwk Chain C (length=9) Species: 12110 (Foot-and-mouth disease virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MTAHITVPY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kwk Peptidomes and Structures Illustrate Two Distinguishing Mechanisms of Alternating the Peptide Plasticity Caused by Swine MHC Class I Micropolymorphism.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y7 R62 E63 N66 T73 Y74 Y84 L95 Y99 D116 T143 K146 W147 E152 R155 R156 Y159 S167 R170 Y171
Binding residue
(residue number reindexed from 1)		Y7 R62 E63 N66 T73 Y74 Y84 L95 Y99 D116 T143 K146 W147 E152 R155 R156 Y159 S167 R170 Y171
Enzymatic activity
Enzyme Commision number ?
External links