Structure of PDB 6kvm Chain A Binding Site BS01

Receptor Information

>6kvm Chain A (length=184) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LKPHVLLQAEFYQRSEGPDKAWAQFGFHFDADELFHVELDAAQTVWRLPE
FGRFASFEAQGALQNMAVGKQNLEVMISNSNRSQQDFVTPELALFPAEAV
SLEEPNVLICYADKFWPPVATMEWRRNGAVVSEGVYDSVYYGRPDLLFRK
FSYLPFVPQRGDVYSCAVRHWGAEGPVQRMWEPE

Ligand information

>6kvm Chain C (length=17) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PGDSDIIRSMPEQTSEK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6kvm A Newly Recognized Pairing Mechanism of the alpha- and beta-Chains of the Chicken Peptide-MHC Class II Complex.
Resolution	1.897 Å
Binding residue (original residue number in PDB)	Q8 F27 A55 S56 F57 G61 Q64 N65 V68 N72 V75 N79
Binding residue (residue number reindexed from 1)	Q8 F27 A55 S56 F57 G61 Q64 N65 V68 N72 V75 N79

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6kvm, PDBe:6kvm, PDBj:6kvm
PDBsum	6kvm
PubMed	32034060
UniProt	Q4U5Z6

[Back to BioLiP]