Structure of PDB 6kum Chain A Binding Site BS01

Receptor Information

>6kum Chain A (length=94) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AYKVTLKTPSGDKTIECPADTYILDAAEEAGLDLPYSCRAGACSSCAGKV
AAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQTHQEEAL

Ligand information

InChI=1S/2Fe.2S

NIXDOXVAJZFRNF-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04	[Fe]1S[Fe]S1
CACTVS 3.341 OpenEye OEToolkits 1.5.0	S1[Fe]S[Fe]1

Formula

Fe2 S2

Name

FE2/S2 (INORGANIC) CLUSTER

PDB chain

6kum Chain A Residue 101 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6kum X-ray dose-dependent structural changes of the [2Fe-2S] ferredoxin from Chlamydomonas reinhardtii.
Resolution	1.4 Å
Binding residue (original residue number in PDB)	S36 C37 R38 G40 C42 C45 C75
Binding residue (residue number reindexed from 1)	S37 C38 R39 G41 C43 C46 C76
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0051536	iron-sulfur cluster binding
GO:0051537	2 iron, 2 sulfur cluster binding

	Biological Process
GO:0022900	electron transport chain

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6kum, PDBe:6kum, PDBj:6kum
PDBsum	6kum
PubMed	32282907
UniProt	P07839\|FER_CHLRE Ferredoxin, chloroplastic (Gene Name=PETF)

[Back to BioLiP]