Structure of PDB 6kug Chain A Binding Site BS01

Receptor Information
>6kug Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKYLRSVGDG
ETVEFDVVEGEKGAEAANVTGPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kug DrosophilaYBX1 homolog YPS promotes ovarian germ line stem cell development by preferentially recognizing 5-methylcytosine RNAs.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		K64 W65 N67 N70 Y72 F74 D83 F85 H87 K118 E121
Binding residue
(residue number reindexed from 1)		K13 W14 N16 N19 Y21 F23 D32 F34 H36 K62 E65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6kug, PDBe:6kug, PDBj:6kug
PDBsum6kug
PubMed32015133
UniProtP67809|YBOX1_HUMAN Y-box-binding protein 1 (Gene Name=YBX1)

[Back to BioLiP]