Structure of PDB 6ktc Chain A Binding Site BS01

Receptor Information
>6ktc Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNLRSVGD
GETVEFDVVEGEKGAEAANVTGPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ktc DrosophilaYBX1 homolog YPS promotes ovarian germ line stem cell development by preferentially recognizing 5-methylcytosine RNAs.
Resolution2.008 Å
Binding residue
(original residue number in PDB)		W15 N17 N20 Y22 F24 D33 F35 H37 K68 E71
Binding residue
(residue number reindexed from 1)		W14 N16 N19 Y21 F23 D32 F34 H36 K63 E66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6ktc, PDBe:6ktc, PDBj:6ktc
PDBsum6ktc
PubMed32015133
UniProtP67809|YBOX1_HUMAN Y-box-binding protein 1 (Gene Name=YBX1)

[Back to BioLiP]